top of page

CircRNA

Gene

chr6|89749222|89751582|-|4|circRNA|MDN1|ENST00000369393.7|26,25,24,23

MDN1

Open Reading Frame (ORF)

LWNCTLMSYLAPSWKQSCTSGVVCHPPIAASWLKSCWIFSLFQSQKEVGLSRLKATGLRWETRSLQ

Peptide

LKATGLR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page