top of page

CircRNA

Gene

chr6|70452491|70502791|+|8|circRNA|FAM135A|ENST00000418814.6|5,6,7,8,9,10,11,12

FAM135A

Open Reading Frame (ORF)

LLTFDGFMGTVSGSYNATRRTKNIISTRAPYFEVFTRFVLL

Peptide

NIISTRAPYFEVFTR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page