top of page

CircRNA

Gene

chr6|54870186|54870690|+|1|circRNA|FAM83B|ENST00000306858.7|2

FAM83B

CircRNA UID

circFAM83B(2)

Open Reading Frame (ORF)

LAICDARTLRGHPYRSPFSSTKSTSTYDKRNYSEDDKRSKKDTSHHCMNGHLKVP

Peptide

DTSHHCMNGHLKVP

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

NA

TranCirc

Potential Cryptic Translation

false

bottom of page