top of page

CircRNA

Gene

chr6|345928|348102|+|1|ciRNA|DUSP22|ENST00000603296.5|5

DUSP22

Open Reading Frame (ORF)

LPARVPCSHPADTVCLLCTLHIYVRKSTKVRLGKGFSTSWALKIIDLALI

Peptide

LGKGFSTSWALK

ORF Found in Long-Read

false

Peptide Length

12

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

12

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page