top of page

CircRNA

Gene

chr6|34091882|34133859|-|2|circRNA|GRM4|NM_000841|3,2

GRM4

Open Reading Frame (ORF)

MGTSHWEACSRCMAGAQRASPVENLRRKRASTGWRPCCSPWIASTTTRTCCLTSRWAPAFWTPAPGTPMPSSSR

Peptide

CMAGAQRASPVENLR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000109

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page