top of page

CircRNA

Gene

chr6|25963048|25969420|+|3|circRNA|TRIM38|NM_006355|2,3,4

TRIM38

Open Reading Frame (ORF)

MSGAQDRNPGALEGGEPHLPRRAVTPAERGLVYHWRK

Peptide

NPGALEGGEPHLPRR

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page