top of page

CircRNA

Gene

chr6|17462995|17507726|+|3|circRNA|CAP2|ENST00000229922.6|4,5,6

CAP2

Open Reading Frame (ORF)

MNDAATFYTNRVLKDYKHRQKWCTVLSRPSGLSF

Peptide

QKWCTVLSRPSGLSF

ORF Found in Long-Read

false

Peptide Length

15

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

15

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page