top of page

CircRNA

Gene

chr6|166366636|166366794|-|1|ciRNA|MPC1|ENST00000360961.10|3

MPC1

Open Reading Frame (ORF)

LHFKIVALDVTVTIRKSHTECDGMEECYFSMSVRSKNADLDNWEDFQHSRAPACISRL

Peptide

IVALDVTVTIR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page