top of page

CircRNA

Gene

chr6|154773988|154810208|+|11|circRNA|SCAF8|ENST00000367178.7|2,3,4,5,6,7,8,9,10,11,12

SCAF8

Open Reading Frame (ORF)

LALESVNTESDHAPAQEKERGNHHGRIQVKGEPEKGRKNDRKRDYLQLDLKH

Peptide

RDYLQLDLK

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page