top of page

CircRNA

Gene

chr6|154410342|154414423|-|3|circRNA|CNKSR3|ENST00000616478.4|12,11,10

CNKSR3

Open Reading Frame (ORF)

LSMPADGNWMGIVDPFARPRGHGRKDLTSTRDNPVP

Peptide

KDLTSTR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page