top of page

CircRNA

Gene

chr6|150936803|150972058|+|9|circRNA|MTHFD1L|ENST00000367321.7|12,13,14,15,16,17,18,19,20

MTHFD1L

Open Reading Frame (ORF)

LADKIALKLVGEEGFVGSHPPLLEKGRAQSPSGLCRL

Peptide

AQSPSGLCR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page