top of page

CircRNA

Gene

chr6|145934906|145935441|-|2|circRNA|SHPRH|ENST00000367505.6|13,12

SHPRH

Open Reading Frame (ORF)

LGSEAQQPRQKDCHLYPVSIAEAQTGLLSPTGCSWRVLATPKKIFLG

Peptide

LGSEAQQPR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page