top of page

CircRNA

Gene

chr6|136147350|136155758|+|5|circRNA|PDE7B|NM_018945|4,5,6,7,8

PDE7B

Open Reading Frame (ORF)

LQTYIRYNILRGDWHQEKGEKTIKLSKILPCIKAASWNYTTSPSAPAG

Peptide

GDWHQEK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

true

bottom of page