top of page

CircRNA

Gene

chr6|135192323|135200415|+|8|circRNA|MYB|ENST00000339290.9|6,7,8,9,10,11,12,13

MYB

Open Reading Frame (ORF)

LEFYNASEGRTGRLSAGVFKSQPASSGHKLPEEQSFDGFCSGSAYSSTPCHWPAHC

Peptide

LSAGVFK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page