top of page

CircRNA

Gene

chr6|131884930|131886724|+|2|circRNA|ENPP1|ENST00000360971.6|23,24

ENPP1

Open Reading Frame (ORF)

LIPTHFFIVLTSCKDTSQTPLHCENLDTLAFILPHRTDNSESCVLYGATFMTPYCESMLKKEMVSMSSVVLCLTLIMMDVVIP

Peptide

EMVSMSSVVLCLTLIMMDVVIP

ORF Found in Long-Read

false

Peptide Length

22

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

22

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page