top of page

CircRNA

Gene

chr6|117693041|117694180|+|2|circRNA|NUS1|NM_138459|2,3

NUS1

Open Reading Frame (ORF)

LPFGSEGAVSGRWKSRYCKSCSGLLPVSSPEAKETHRFGCRYVSQFT

Peptide

ETHRFGCR

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page