top of page

CircRNA

Gene

chr6|110632029|110670541|-|4|circRNA|CDK19|ENST00000368911.7|6,5,4,3

CDK19

Open Reading Frame (ORF)

MGFARLFNSPLKPLADLDPVVVTFWYRAPELLLGARHYTKAIAFARIEAP

Peptide

HYTKAIAFAR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TAA

Peptide Type

Junction

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page