top of page

CircRNA

Gene

chr5|95748332|95755761|+|3|circRNA|RHOBTB3|NM_014899|4,5,6

RHOBTB3

Open Reading Frame (ORF)

LHFQVLAMNLQATHHYESLLKTPSSVLVYQTSFASFIQKSYLVHAHYVPQTEGAVLVQLKGSNLQKN

Peptide

TPSSVLVYQTSFASFIQK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page