top of page

CircRNA

Gene

chr5|94888878|94912976|-|4|circRNA|MCTP1|ENST00000515393.5|12,11,10,9

MCTP1

Open Reading Frame (ORF)

LRIFHNLKDVGFLQVKVIRAEGLMAADVTVSDPKFTPIRPTQKIASLERNSQHHLD

Peptide

VIRAEGLMAADVTVSDPK

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

5

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page