top of page

CircRNA

Gene

chr5|80678926|80792844|+|12|circRNA|MSH3|ENST00000265081.6|8,9,10,11,12,13,14,15,16,17,18,19

MSH3

Open Reading Frame (ORF)

LMCCWENRINMSQIIQIYQECSLPQARLCLIVSRTLLLVQS

Peptide

INMSQIIQIYQECSLPQAR

ORF Found in Long-Read

false

Peptide Length

19

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

8

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page