top of page

CircRNA

Gene

chr5|79277909|79291299|+|3|circRNA|JMY|NM_152405|2,3,4

JMY

Open Reading Frame (ORF)

LCMIECELIRRNLVKHHGQRLLNGWKNSSMQFLRKLCR

Peptide

LCMIECELIR

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

10

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page