top of page

CircRNA

Gene

chr5|76697986|76701213|+|2|circRNA|IQGAP2|ENST00000274364.10|33,34

IQGAP2

Open Reading Frame (ORF)

LHEKGVLLDIDDLQTNQIFEIKESIVSFEKLNWQNFSRP

Peptide

IFEIKESIVSFEK

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page