top of page

CircRNA

Gene

chr5|72848384|72855923|+|3|circRNA|TNPO1|ENST00000337273.9|2,3,4

TNPO1

Open Reading Frame (ORF)

LSGLILKNNVKAHFQNFPNGVTDFIKSECLNNIGDSSPLIRATVANQDGV

Peptide

ATVANQDGV

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page