top of page

CircRNA

Gene

chr5|67144668|67153580|+|5|circRNA|MAST4|NM_001164664|22,23,24,25,26

MAST4

Open Reading Frame (ORF)

MPGRTEGWRSYHSHQWRTSAWTCPHRSYRTPTEGFQQYRSNHSEFSRREGRLCGQNQKHHLAIHRNTELEFRIF

Peptide

HHLAIHR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page