top of page

CircRNA

Gene

chr5|6610954|6632756|-|10|circRNA|NSUN2|ENST00000264670.10|11,10,9,8,7,6,5,4,3,2

NSUN2

CircRNA UID

circNSUN2(11,10,9,8,7,6,5,4,3,2)

Open Reading Frame (ORF)

MTKDGQWFTDWDAVPHSRHTQIRPTMFPPKDPEKLQAMHLERWAGKEATPRSSRRTSCSSTTTRSSRSCPRASGASSWTLSGSRSRPL

Peptide

ASGASSWTLSGSRSRPL

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

NA

Potential Cryptic Translation

false

bottom of page