top of page

CircRNA

Gene

chr5|61472680|61490934|+|2|circRNA|ZSWIM6|ENST00000252744.5|2,3

ZSWIM6

Open Reading Frame (ORF)

MKSRFKNRLNCSFPRAGTTDQGSSLICSLQRFPLERHSDRTCNTIGARNCLQRGHQL

Peptide

AGTTDQGSSLICSLQR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page