top of page

CircRNA

Gene

chr5|58975656|59038971|-|9|circRNA|PDE4D|ENST00000340635.10|14,13,12,11,10,9,8,7,6

PDE4D

Open Reading Frame (ORF)

MLPWKNHRGGLPETGQRDPGGAGLVSGPARDPTDQALRQ

Peptide

DPGGAGLVSGPAR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page