top of page

CircRNA

Gene

chr5|43609142|43628387|+|6|circRNA|NNT|NM_012343|2,3,4,5,6,7

NNT

Open Reading Frame (ORF)

MQGGRHPYQHSTYSSDLPSRKLGSQKIGNSYQHGKPIENSGDWLLVSST

Peptide

IGNSYQHGKPIENSGDWLLVSST

ORF Found in Long-Read

false

Peptide Length

23

Stop Codon

TAG

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

23

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page