top of page

CircRNA

Gene

chr5|43453657|43454605|-|2|circRNA|C5orf28|ENST00000512085.5|3,2

C5orf28

Open Reading Frame (ORF)

LFVMASETEKTHALLQTCSTESLISSLGLGAFCLVADRLLQFSTIQQNDWLRALSDNAVHCVIGMWSWAVVTGIKKKTDFGEIILAGFLASVIDVDHFFLAGSMSLKAISCSGAHGLQEEELSLPQDKFWKGI

Peptide

AISCSGAHGLQEEELSLPQDKFWK

ORF Found in Long-Read

false

Peptide Length

24

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

24

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page