top of page

CircRNA

Gene

chr5|37238856|37239869|-|2|circRNA|C5orf42|ENST00000508244.5|7,6

C5orf42

Open Reading Frame (ORF)

LLLSVVALKDVVTRVPWFQLHLLDHCHTMFIGLNKTVISVV

Peptide

VPWFQLHLLDHCHTMFIGLNK

ORF Found in Long-Read

false

Peptide Length

21

Stop Codon

TAA

Peptide Type

Junction

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

12

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page