top of page

CircRNA

Gene

chr5|36961483|36986301|+|6|circRNA|NIPBL|NM_015384|5,6,7,8,9,10

NIPBL

CircRNA UID

circNIPBL(5,6,7,8,9,10)

Open Reading Frame (ORF)

LCYKNCLWMMFRNLLKIERTNQEVPLNLSRINHQSQIKE

Peptide

INHQSQIKE

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TGA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

Ribo-Seq Peptide Support

Ribo-Seq CircRNA Support

TransCirc

TranCirc

Potential Cryptic Translation

false

bottom of page