top of page

CircRNA

Gene

chr5|31451532|31472232|-|5|circRNA|DROSHA|NM_001100412|20,19,18,17,16

DROSHA

Open Reading Frame (ORF)

MMLPVLTHHIRYHQCLMHLDKLIGYTFQDRCLLQMEERKCCPCTRFSCTC

Peptide

LIGYTFQDRCLLQMEER

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

4

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page