top of page

CircRNA

Gene

chr5|170892386|170968377|+|11|circRNA|RANBP17|ENST00000523189.5|4,5,6,7,8,9,10,11,12,13,14

RANBP17

Open Reading Frame (ORF)

LQFCGSWISFVKHMLVINFKEPQRKLHSELRGITAQAGSLCHPSSYSSHC

Peptide

HMLVINFK

ORF Found in Long-Read

false

Peptide Length

8

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page