top of page

CircRNA

Gene

chr5|157732867|157735934|+|3|circRNA|THG1L|ENST00000231198.11|2,3,4

THG1L

Open Reading Frame (ORF)

LGTYTTIWTNTSTSPREITGLLRSTTLQNPMTAVLSS

Peptide

LGTYTTIWTNTSTSPR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page