top of page

CircRNA

Gene

chr5|150618102|150618767|+|1|circRNA|SYNPO|NM_001166208|2

SYNPO

Open Reading Frame (ORF)

LHPAKGGLPPAPSRSLMEATGVWLWKPRRAAVRRACRERWGLPTWKRMRGSAGVGTTLPAESPRGHRSCPKPWASNHPAAPERNKGRPSTTTGPARTGM

Peptide

GGLPPAPSR

ORF Found in Long-Read

false

Peptide Length

9

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000116

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

9

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

true

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page