top of page

CircRNA

Gene

chr5|150199227|150202703|+|4|circRNA|SLC6A7|ENST00000230671.6|5,6,7,8

SLC6A7

Open Reading Frame (ORF)

LGNAITSILAGFAIFSVLGYMSQELGVPVDQVAKAAATSSTSKAARASAALGRSAGTSASACCWPGSSCSSVSSRV

Peptide

ASAALGR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA,PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page