top of page

CircRNA

Gene

chr5|146498686|146503305|+|1|ciRNA|TCERG1|NM_001040006|15

TCERG1

Open Reading Frame (ORF)

LLIRIKGQLLKINEFQMSFDSSVRSGEELTTGEEN

Peptide

IKGQLLK

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Alternative

Start Codon

TTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page