top of page

CircRNA

Gene

chr5|146218984|146251875|+|8|circRNA|RBM27|ENST00000265271.6|2,3,4,5,6,7,8,9

RBM27

Open Reading Frame (ORF)

MVLLHLSDFSWGHRLLCWQLVWCHLETSWDPPLDTIPQSPALPLWFQM

Peptide

MVLLHLSDFSWGHR

ORF Found in Long-Read

false

Peptide Length

14

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

14

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page