top of page

CircRNA

Gene

chr5|14286870|14316743|+|6|circRNA|TRIO|ENST00000344204.8|4,5,6,7,8,9

TRIO

Open Reading Frame (ORF)

LTPGSSDSLTASANYSKAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQRGGLQAWLHGDRGHAWVQVGLHQAPSEDPAGVLPLLHPCGPDHQARQLLAETED

Peptide

LHQRLQLCVFQQDVQQR

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TAA

Peptide Type

Junction

Frame

1

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

1

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page