top of page

CircRNA

Gene

chr5|137941943|137943216|-|3|circRNA|FAM13B|NM_001101800|21,20,19

FAM13B

Open Reading Frame (ORF)

LNYWNNFGKPELKKRNYAKRCGNLKKHFINKMEGISIHQAKGSDVTANHRRRNCTFF

Peptide

MEGISIHQAK

ORF Found in Long-Read

false

Peptide Length

10

Stop Codon

TGA

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page