top of page

CircRNA

Gene

chr4|98416744|98421394|+|5|circRNA|RAP1GDS1|NM_001100426|8,9,10,11,12

RAP1GDS1

Open Reading Frame (ORF)

LGKNVKLVERLVEWCEAKDHAGVMGESNRLLSALIRHSKSKMLLNYSWLKQA

Peptide

SKMLLNYSWLK

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TAG

Peptide Type

Junction

Frame

3

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

TTG

Number of Amino Acids from 3' Exons

8

Number of Amino Acids from 5' Exons

3

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page