top of page

CircRNA

Gene

chr4|94640275|94657547|+|3|circRNA|PDLIM5|ENST00000437932.5|8,9,10

PDLIM5

Open Reading Frame (ORF)

MFFTWRMVNPTVRLYLPLEESQTALLTQDQWHQPTQLWDKPSQVTRTL

Peptide

MVNPTVR

ORF Found in Long-Read

false

Peptide Length

7

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

TCGA

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page