top of page

CircRNA

Gene

chr4|90308243|90313047|+|2|circRNA|CCSER1|NM_001145065|2,3

CCSER1

Open Reading Frame (ORF)

LRSSSEGTAGSSRMILKPKDGNIEEVNSLRKQRAGSSSSKMNSLAAKLAFTVQAFDSQWGTQDQDDLPWSPGCQYSEEVLTEDMILFLLHLLPVIQLVSTVPLLPALTQAQVAQVNGGAYSVLLPLASTIRRGVSLSKSLPTRTLVFQMVLNLVTAICRN

Peptide

TLVFQMVLNLVTAICRN

ORF Found in Long-Read

false

Peptide Length

17

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

TCGA

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

17

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

TRUE

Peptide Exists in PepTransDB

false

bottom of page