top of page

CircRNA

Gene

chr4|88652868|88680236|+|15|circRNA|HERC3|ENST00000402738.5|6,7,8,9,10,11,12,13,14,15,16,17,18,19,20

HERC3

Open Reading Frame (ORF)

MECLPTIKIQISCGFQTRWPVLHLGKEQPWAAWLREGVPLPSQPTEGEVPGGDPTGSGGCRRGSQLCPVSLRSCFWLGDE

Peptide

EQPWAAWLREGVPLPSQPTEGEVPGGDPTGSGGCR

ORF Found in Long-Read

false

Peptide Length

35

Stop Codon

TAA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

35

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page