top of page

CircRNA

Gene

chr4|88038250|88052158|+|4|circRNA|PKD2|NM_000297|4,5,6,7

PKD2

Open Reading Frame (ORF)

LLSQYFLSGLSSQKAPYWMGCTGRCSPATRLKLTTEVSSSMRTCC

Peptide

APYWMGCTGRCSPATR

ORF Found in Long-Read

false

Peptide Length

16

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

16

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page