top of page

CircRNA

Gene

chr4|86948497|87047594|+|3|circRNA|AFF1|ENST00000395146.8|2,3,4

AFF1

Open Reading Frame (ORF)

LCFGDRFGSREGAFSLNLFAFPSSPFVTYTFQPANSSPDARKQQGSWQQQ

Peptide

EGAFSLNLFAFPSSPFVTYTFQPANSSPDARK

ORF Found in Long-Read

false

Peptide Length

32

Stop Codon

TAA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

32

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page