top of page

CircRNA

Gene

chr4|77726166|77756951|-|7|circRNA|CNOT6L|ENST00000504123.5|11,10,9,8,7,6,5

CNOT6L

Open Reading Frame (ORF)

MNFSCNGKNGSSEGRITHGFQLKSAYENNLMPYTNYTFDFKAILYHRIFSTYTRTQMEPESY

Peptide

AILYHRIFSTYTR

ORF Found in Long-Read

false

Peptide Length

13

Stop Codon

TGA

Peptide Type

Alternative

Frame

3

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

13

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page