top of page

CircRNA

Gene

chr4|76256177|76263843|+|2|circRNA|FAM47E|NM_001136570|2,3

FAM47E

Open Reading Frame (ORF)

LWRAFCPRFITELPNWPQRRGRSSCSRKQTCFPSSRQPSRLGRHSWRTWRPT

Peptide

FITELPNWPQR

ORF Found in Long-Read

false

Peptide Length

11

Stop Codon

TGA

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Alternative

Start Codon

CTG

Number of Amino Acids from 3' Exons

11

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page