top of page

CircRNA

Gene

chr4|73409362|73412015|+|1|ciRNA|ALB|ENST00000621085.4|5

ALB

Open Reading Frame (ORF)

MNFKNYFCMSILNFLMRNSICLVFSYKISHDNTILIGDFLFRAVARLSHEIARRHPYFYAPELLFFAKRYKAAFTECCQAADKAACLLPKVLCKRIEKKSSLSNLILSILWLDLGNLSV

Peptide

SHEIARR

ORF Found in Long-Read

true

Peptide Length

7

Stop Codon

TGA

Peptide Type

Alternative

Frame

1

Proteome Support

PDC000116

ORF Type

Junction

Start Codon

ATG

Number of Amino Acids from 3' Exons

7

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page