top of page

CircRNA

Gene

chr4|48563947|48567420|-|4|circRNA|FRYL|ENST00000503238.5|28,27,26,25

FRYL

Open Reading Frame (ORF)

LWTAATRAPGGWRPAALKPLLMFSRTVQVVALIMKHIFSTTLYWNM

Peptide

APGGWRPAALKPLLMFSR

ORF Found in Long-Read

false

Peptide Length

18

Stop Codon

TAG

Peptide Type

Alternative

Frame

2

Proteome Support

PDC000109

ORF Type

Junction

Start Codon

CTG

Number of Amino Acids from 3' Exons

18

Number of Amino Acids from 5' Exons

0

Short Read Rescue Status

NA

CircRNA Exists in PepTransDB

false

Differentially Expressed in mCRC

NA

Peptide Exists in PepTransDB

false

bottom of page